PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G0872
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Nin-like
Protein Properties Length: 906aa    MW: 100830 Da    PI: 6.9632
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G0872genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.81.2e-29587638152
       RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  aek+i+l++l++yF++++kdAAk+Lgvc+T+LKriCRq+GIkRWP+Rkik++
  Gh_D01G0872 587 AEKTITLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGIKRWPSRKIKKV 638
                  589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.905577658IPR003035RWP-RK domain
PfamPF020423.5E-26590638IPR003035RWP-RK domain
SuperFamilySSF542777.57E-23809896No hitNo description
SMARTSM006662.7E-27810893IPR000270PB1 domain
PROSITE profilePS5174526.338810893IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.0E-22811890No hitNo description
PfamPF005644.6E-19812892IPR000270PB1 domain
CDDcd064076.68E-40812891No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 906 aa     Download sequence    Send to blast
MDFDYMDELL LDGCWLETTQ GSDFLNPTLP FSNNFFDPAF TWPTSESNAG DLGGGLSHQG  60
ENQRSLLSGN SHWNEAQGES LVSPHFSQSH SLDSDCVTDG SEPNRRWWIG PRVNSGPATS  120
VMQRLIQALG YIKAFGKEKD VLVQLWLPVN RGGRRFLTTS EQPFSLDPNS QKLASYRNIS  180
VKYDFPAEED SKDIAGLPGR VFLSKVPEWT PDVRFFKRDE YPRVGHAQEH DVRGTFALPV  240
FEQGSGTCLG VIEVVMTTEK IKIQPELESV CKALEAVNLR SSITSRTQNI KAYSNCYQAA  300
LPEIKELLRC ACETHRLPLA QAWVPCIQQG KEGCRHSSEN YVHCVSTVDD ACCIADPSIQ  360
GFHEACSEHH LLKGQGVIGR AFMTNQPCFS TDITSFKKTE YPLAHHAMMF NLHAAVALRF  420
RSIHTGKADF VLEFFLPAHC RDPEGQRKML NSLSIIIQQV CCSLRVVTDK ELVEETDLAV  480
SEVVAPSDGL PIREESSKRQ CTNHHSKKLS GESSSCLTKV QKSSNTALVL EKEKPRPMLD  540
EKLPEVEQHQ QHISLQESVE CGDSTFNEIS FSSVTMGKTS EKRRSKAEKT ITLQVLRQYF  600
AGSLKDAAKS LGVCPTTLKR ICRQHGIKRW PSRKIKKVGH SLQKLQHVID SVQGASGAFH  660
ISNFYANFPE LASPKLLGNS ALSTSPLNDK PKQINIQPEG GDFLSQAALS NSPSSSCSQS  720
SSSSHSCSSG THRPSNFNMS GKEDHIIGDN SGDGELKRVK SDVELHASSQ EGPKLFPRSQ  780
SLRSLKEQLI CDNLQPISKN TSPIAHDLEA QRVKVTYGDE KIRLRMQSKW RFKDLLHEIA  840
RRFNIDDISR FDLKYLDDDS EWVLLTCDAD MVECIDVCGS SQGNTIKLSL RVSHHHLDQF  900
SGSTGS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464624.10.0PREDICTED: protein NLP4-like
RefseqXP_012464617.10.0PREDICTED: protein NLP4-like
RefseqXP_012464609.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A0D2M9P10.0A0A0D2M9P1_G
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein